DPCstruct | MC10032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 702 ± 61 aa |
| Standard deviation of domain lengths | 61.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13089- CL0479- CL0764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257NHA9 | 226-921 | MDINEAVETINLESPELYINRDLSLLEFNKRVLAQAKNEAVPLLERLNYLCISCSNLDEFFEVRVASVLEMVAIDPKAIGPDGLTPK… |
| M2WYX5 | 92-866 | TIDSQEDIALAREAGVPEASRTVSVVNVQIAVPLNVSMDSSNAEPAEVSSVSSASSAAVTAATIGKDACLRLLDGKEYIVVPPEPVW… |
| C7XWA2 | 4-712 | None |
| A0A316P363 | 21-743 | None |
| A0A2H6A6Z4 | 367-1069 | None |
| A0A644Y4R0 | 1-646 | None |
| A0A2N6V5H4 | 188-933 | None |
| A0A7W1PH49 | 211-904 | None |
| S2WX32 | 303-1000 | None |
| A0A836ZKS0 | 2-601 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.