DPCstruct | MC10031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 150 ± 21 aa |
| Standard deviation of domain lengths | 21.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05620 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2W1J3 | 19-158 | MAQNSARNTLKGNQSRLRYLRNLILGSNVSYIFLRMVLRRNSYTVVQFLLWLISVLLSASCFFFLYDAAKPTYDRGTLIDGGYDISK… |
| A0A821LI78 | 55-224 | MPPKKAPTKGAKQILVENEATISFYRNMAGASGLFYNSVMFGIYHDEVRSWLMFMNVFVLAIYLGCYQLMRYISRPTYSELGLLIDP… |
| A0A6A5C9T5 | 3-179 | None |
| A0A6V7Y041 | 30-193 | None |
| A0A7J6S6E8 | 1-166 | None |
| A0A1E3HRP3 | 152-336 | None |
| A0A2A6C9U6 | 117-255 | None |
| A0A1Y1W1P0 | 8-153 | None |
| M9LSY8 | 42-222 | None |
| Q5CWR4 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.