DPCstruct | MC1003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Standard deviation of domain lengths | 9.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P8NEN2 | 40-166 | MEIFNIIVLLISGLLVFTFAGVLRLINPIKNYLKNTGIKLENEVNLLSEARGMSSVMMFGGIIIVSGIFIPKMTIISFAVAILLFLG… |
| A0A2P2DXZ1 | 13-131 | HPLGSDTFLLFVSFLFAGMGISAFPNPVWITKQFGISELTASGKNEVRAVYGGFGLCMSLALILAYCIPEIRNGVCITVALALFGMS… |
| A0A2E3DL48 | 2-121 | None |
| A0A839T4A0 | 4-133 | None |
| A0A524BK23 | 1-103 | None |
| A0A1Y6BR46 | 5-133 | None |
| A0A521ZJ03 | 8-124 | None |
| A0A534Q397 | 62-184 | None |
| A0A518BLF9 | 2-122 | None |
| A0A354VFH5 | 9-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.