DPCstruct | MC10029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 10.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0FSG0 | 128-238 | LHENRLDVGKCRKLIDVVVTVLPEWKLEFITEFLKDNKKMEDFEKLHLFPVFCSWSGSEVPLILEKIEFLKSLKDNLKGIDYIEHKK… |
| A0A1E2WW24 | 13-122 | VISKYKEIEFIQFISDIVINFSYERRRSFIDCFIKHNKNFEDFEKLRLEPSSWGCSGSWVPVYQKRVEYLESLLPLFNSVDFLQHKQ… |
| A0A378K4G2 | 1-91 | None |
| A0A840R2A6 | 11-85 | None |
| A0A645JD41 | 51-162 | None |
| A0A850KH76 | 3-102 | None |
| A0A483AKJ3 | 360-469 | None |
| A0A450VTG6 | 177-288 | None |
| A0A1I0KBV3 | 543-652 | None |
| A0A1H9F3Z9 | 251-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.