DPCstruct | MC10027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 166 ± 25 aa |
| Standard deviation of domain lengths | 25.10 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 93.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q2T7W4 | 326-510 | NWWEIGVYYRSGDGKVAFEKDVKAGKLDHWLNQVLFYTCLENYNKIRSLEGSDGRWYYNELSLDNNKGQVHDPLDKSQPETLASQQL… |
| A0A854KD38 | 8-139 | FLRKSTLWTCISHKNHCLSFDGTDGRFYNNEMCLDENSLVRKELVEREKYGKLDRADFMLLGVFDELLELVKNTQEYNPCYNYGTYQ… |
| A0A1L7MZ85 | 237-371 | None |
| A0A140NRK6 | 188-340 | None |
| A0A174TED3 | 567-759 | None |
| A0A4P7M5D4 | 35-210 | None |
| A0A7K3IFT3 | 1-124 | None |
| A0A417DP47 | 432-626 | None |
| S5G9J0 | 387-562 | None |
| A0A7K1A0H1 | 208-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.