DPCstruct | MC10025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 322 ± 42 aa |
| Standard deviation of domain lengths | 42.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.56 |
| Pfam Score | 39.29 |
| Assigned Pfam label(s) | PF02457- PF21753- PF21751- PF21750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A259TUA8 | 48-391 | RRLTPHLNRLWGTARASLDEWLNTLSDPPRPREIEAVQEALVLKWLDLMAPPVDWIKLLSYVERLRQRSYENAPVSVNLVVCQEEGD… |
| A0A356F1R3 | 16-343 | EMFSYEFPTLPIQHIDLFLGMFYQLANYEEEGQKIKPTILITNNINNVVKNVNKAKKIIFYEDSDTLNFRARIKALMCFCKRDWNIY… |
| A0A2P6HIH1 | 341-663 | None |
| A0A848LZ62 | 20-381 | None |
| A0A7C8FEL8 | 2-402 | None |
| A0A2P9H227 | 2-209 | None |
| A0A2C0YRK1 | 252-522 | None |
| A0A349MFL4 | 265-645 | None |
| A0A0B4C4A1 | 7-283 | None |
| A0A6N7FQX8 | 14-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.