DPCstruct | MC10020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 149 ± 13 aa |
| Standard deviation of domain lengths | 12.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2ZIE8 | 57-221 | KREGVCAASLPTTMGIVAGLLVQNALKHLLNFGQVSACLGYNAMKDFFSLMVLQPNPSCSDSWCLKQQEQYLQKAKAEEKNRAAVGG… |
| A0A6B2G380 | 2-125 | SIISGLLVQNALKYLLEFGEISNHVGYNALSDYFNQLNFIPNPECFDSNCKSNQIEYQNGKMSLENLVDTNPEPEMIKPENPWGIKL… |
| A0A7S0D6L5 | 22-179 | None |
| A0A4V5ZZU0 | 89-228 | None |
| A0A6V7TPI5 | 2-149 | None |
| A0A139Y551 | 12-163 | None |
| A0A2A2KXU5 | 601-758 | None |
| A0A498NDZ0 | 177-333 | None |
| A0A226NZQ0 | 26-174 | None |
| A0A7S4BWC2 | 57-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.