DPCstruct | MC1002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 204 ± 42 aa |
| Standard deviation of domain lengths | 42.35 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C6FL89 | 62-273 | TTDDPESLEDLSEDQPPIEEALVEMAYNVSGRERGMVRCVFCKHPNHFNGVVMRYKSGTRRLVGRDCAGKHYGVTFDLLARDFDAAR… |
| A0A2N1WHA2 | 1-255 | MILDGKLVHLASWSDLIDRADFAGRLDESIYSPLKEIVGIYTLKEKHQCGRSECGKWHYNGYVVIAASDQLINIGKDCGTNFFDVDF… |
| A0A1E4WD57 | 4-191 | None |
| A0A699GF10 | 1-182 | None |
| A0A3V8DVD9 | 1-178 | None |
| A0A5B9GLD8 | 27-318 | None |
| B1Z8H7 | 145-291 | None |
| K0CH32 | 3-171 | None |
| A0A7Y6TFT7 | 30-199 | None |
| A0A7G1L550 | 11-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.