DPCstruct | MC10018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 213 ± 17 aa |
| Standard deviation of domain lengths | 17.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6FEL7 | 89-325 | LSPSPNRLIPYVAFLFVSVMAAVGWRVYHYLRECPEGLESLPANSYRIAHLQRSMWEFHFAKSLLAVLLGPIDREARDLADGKVFVP… |
| A0A0N1FXX7 | 78-295 | RPATTPPALGAQVPRTAEDIAETRRSRPNLWEHLLYAGELHVGWTALEAKRLDHALGHRTNGPLIRDEAEAMSHLDAAVQELRQISA… |
| A0A560MBR7 | 399-597 | None |
| A0A2V5B024 | 27-251 | None |
| A0A833HJM3 | 34-250 | None |
| A0A1E3S1P4 | 91-320 | None |
| A0A1D9FEB7 | 16-239 | None |
| A0A0J6VX39 | 8-212 | None |
| A0A1B9Y8Q6 | 88-299 | None |
| A0A3S2XPZ7 | 2-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.