DPCstruct | MC10016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 108 ± 19 aa |
| Standard deviation of domain lengths | 18.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6JMX8 | 16-136 | SESINIADTNDNFGKISFSIGSLVEHICSKDHKSGSSVILEGIFLAEDWTSECPYRQTVKIKGISYSNGVEIIAKDNISKEQALAYK… |
| A0A0V8QI79 | 15-125 | DEPYDVDNFNQNADKIDSAIARKADKSIEKSATLFASSWTGDTAPYYITIDVEGATATNNIEILPAATLIQEQYEAMSSAGITGADQ… |
| A0A318KK67 | 495-623 | None |
| A0A843IGV5 | 34-118 | None |
| A0A416D9Z4 | 48-170 | None |
| R7FW03 | 50-146 | None |
| A0A7K3ZEA5 | 425-519 | None |
| A0A413FIJ3 | 210-326 | None |
| A0A2V2FCF8 | 141-287 | None |
| A0A1E4LG77 | 138-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.