DPCstruct | MC10005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 134 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 46.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6Q789 | 5-140 | AFFAIIVGASATYYSCQEICESHEACAASKYGSYCKSNGVCFGFYHKDDGHCFQPAEQESCDDITLMPVYCPEHEVPEPTCQDVCND… |
| C5LY33 | 177-318 | GIHRIVVADWNYCQDLCEATPGCKNYGWGSYCKGNGVCFGLLDMGDGDYCFEPTDGYNGGYCSDKVYSPVSCPVVDKTCEDLCAETP… |
| A0A7J6SSC1 | 1-115 | None |
| C5LRU8 | 76-215 | None |
| C5L2A9 | 1-143 | None |
| A0A7J6UIR6 | 44-183 | None |
| A0A7J6SQK9 | 11-140 | None |
| A0A7J6MCC0 | 16-152 | None |
| A0A7J6MMW8 | 5-150 | None |
| A0A7J6MLC0 | 11-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.