DPCstruct | MC10004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 248 |
|---|---|
| Mean domain length (aa) | 323 ± 104 aa |
| Standard deviation of domain lengths | 103.70 |
| Length coefficient of variation | 0.32 |
| Mean AlphaFold2 pLDDT confidence score | 82.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.55 |
| Pfam Score | 97.16 |
| Assigned Pfam label(s) | PF00118- PF04782- PF05699- CL0026- PF00079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9XYX0 | 4-188 | YRFDRGYASPYFINDQESNSAILEEPLILLAEDTLATHADVLSILDSVAKTGRSLLIIAHDTEGPAMEMVVINNSRRTVKAAVVKAP… |
| H9H0X6 | 45-374 | ALDDMIHVLKKISTPVDVNNREMMLKIIKSAINTKAINRWSELACSIALDAVRTVELEENGRKEIDIKKYAKVEKIPGGFSEDSCVL… |
| A0A1Z5SAH0 | 549-1058 | None |
| A0A445CCV5 | 12-238 | None |
| A0A2C9KF69 | 2-221 | None |
| A0A7E5W020 | 386-598 | None |
| A0A1V6T0Q3 | 487-894 | None |
| A0A835E4L9 | 341-581 | None |
| A0A835AIR4 | 126-561 | None |
| B7Z532 | 2-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.