DPCstruct | MC10003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 274 ± 30 aa |
| Standard deviation of domain lengths | 30.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0J6S7 | 401-625 | VIWNLQESVNEKKLSPEYEMITNQLIDAYNKAAIETLSSSDVIVWSSSRLVASGKLDEMRLGFHVAPQCLDIHVQLLLNVYCNDHMN… |
| G3UQI9 | 6-329 | SCGLFMYPFFILSNSDPVNEDMLSESRKMITNEKINAYNEAAVRILNSSSRNSKAKVKVFSVSKLIAQETIMKSSDGLHLPESSRDT… |
| C9SPJ3 | 327-565 | None |
| A0A4S2L335 | 232-538 | None |
| A0A8B6CAG4 | 21-265 | None |
| X0L8Y7 | 25-304 | None |
| A0A6I8SWF3 | 35-332 | None |
| A0A2I0THH8 | 18-294 | None |
| A0A5N4DYF0 | 155-457 | None |
| A0A7C8N2X7 | 247-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.