DPCstruct | MC10002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 139 ± 11 aa |
| Standard deviation of domain lengths | 11.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03747 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401SWS7 | 4-134 | NLGLTCMNAVRLLRPGHSDGWKTPFNPKGGGCGAAMRAMCIGLRFPHPNELQMLIEVAVESGRMTHHHPTGYLGSVVAALFTAYAVN… |
| G3UQ97 | 20-157 | MEDMEGRKPGPSSILGTSQLRPGEPHGYRIPFNPTGTGCGAAMRSLAIGLRYPRPEELPTLIQVSIESGRMTHHHPTGYLGALAVAL… |
| A0A7J6AR81 | 96-239 | None |
| A0A6G0HEU1 | 1-123 | None |
| A0A813YJL8 | 84-227 | None |
| G5AVV5 | 70-205 | None |
| A0A3M0JBX9 | 366-505 | None |
| F6T9M9 | 213-376 | None |
| A0A7J5YZQ9 | 128-267 | None |
| A0A3B5KP56 | 2-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.