DPCstruct | MC10001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 202 ± 39 aa |
| Standard deviation of domain lengths | 39.05 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1NQB6 | 4-180 | QDKLEKERNDAKNAVEEYVYEFRDKLSGPYEKFVCEKDLQGFSALLTETEGWLYEEGEDEAKQVYVDKLEDLKKLGTPIEMRYQEAE… |
| A0A0A9KYB9 | 2-136 | EETKEKKNAVEAYVYDMRNKLYDKYSDFVTPEDKDALITKLQEVEDWLYEDGEDETKGVYIAKLEELRRVGNPIEVRFKEWEIRGSA… |
| A0A819XNT0 | 314-552 | None |
| A2YG85 | 35-237 | None |
| A0A287IJL2 | 123-306 | None |
| A0A2D4P4G6 | 2-178 | None |
| A0A5A9N0S9 | 279-429 | None |
| A0A0F7S3H2 | 958-1167 | None |
| A0A5J4NUR2 | 230-446 | None |
| A0A5M9LGS7 | 2-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.