DPCstruct | MC10000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 378 ± 50 aa |
| Standard deviation of domain lengths | 49.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I0Z1J8 | 19-349 | QRAPPDFSDLASPPIDWSLKSRALFLSVQPFSICQEALMAPSSVAFDTLSSFARGSQPGPSCQEQFQHALMTWQHPESSLPGAAVSA… |
| G1NNW6 | 40-324 | SSQPFTWAEHLKAQEEAQGFAQHCRAAEINLPQSVQEPKLSTELRCAFQQSLVYWLHPSLSWLQLFPRIGADRKIAGKACPWAQDEA… |
| A0A7M5WXI6 | 90-500 | None |
| A0A5F5XSP0 | 126-546 | None |
| A0A2K1ICA2 | 238-667 | None |
| A0A3P8SXE1 | 63-475 | None |
| A0A4U1EYH4 | 686-1082 | None |
| A0A0N5A4V6 | 37-398 | None |
| A0A7S0BPT5 | 1-340 | None |
| R1FEP1 | 1-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.