DPCstruct | MC1000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G3BSC0 | 17-106 | LNEEWLRGAEPTLQKAAMWRWFATRYEDPELTTPHDTEGNYLYTEGGPYMADEVLHQHFDTLVPTEVVDELVEHVKSEVGNEWAPKQ… |
| A0A7M3MBV0 | 16-106 | YVSVNELADLSVEEQIEVMRYWFKKHYENPVDRMPYESKEGGYIYISGGPYDAREELSEEFQDMASQMAINKLVEELEEESMEWAGV… |
| A0A6N6Z9P8 | 19-101 | None |
| A0A1I7KCZ2 | 65-154 | None |
| A0A4P8L0B0 | 3-89 | None |
| A0A806LVA4 | 6-81 | None |
| A0A841LKE4 | 89-178 | None |
| A0A434CQ12 | 13-102 | None |
| A7BR78 | 4-100 | None |
| A0A2W4DAV5 | 189-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.