DPCstruct | MC10
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 4.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182KBP7 | 1-56 | TLIPSAPQNFTVEKILPSTDGTFLALAGPKGVSIIELPRRWGPSGQYQNGKECIIC |
| A0A182NQW6 | 1-70 | MNYNQPTRAGGGATLIPSAPQNFTVEKILPSTDGTFLALAGPKGVSIIELPRRWGPNGQYQNGKECIICR |
| A0A1B0GCT4 | 61-125 | None |
| A0A182MT62 | 23-80 | None |
| A0A194PRM4 | 21-77 | None |
| A0A182WNE0 | 62-127 | None |
| Q8CAD9 | 87-157 | None |
| A0A1A9WCP2 | 44-101 | None |
| A0A4Y0BSD4 | 65-126 | None |
| A0A182PJ32 | 62-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.