DPCstruct | MC1
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 25.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497KZ75 | 9-72 | SVDLDFTEVEEHWNCYKLSDGTTLKVKLVLRGVKRLNRYEPDGTPIYVINSINVVRAVNVPEEL |
| A0A7Y5H9I3 | 1-65 | MKEVVSVAVLASKEGFNVYDLADGHTIKMKTVVLDVVRVEGVKDELGNPVYHVQHRVLMTAAPTE |
| A0A537GF50 | 48-114 | None |
| A0A497KRH7 | 1-59 | None |
| A0A419EFN7 | 5-80 | None |
| A0A846NM58 | 17-80 | None |
| A0A564ZH89 | 4-76 | None |
| T1B0E5 | 13-96 | None |
| A0A0F9ER39 | 11-69 | None |
| A0A6I4ZN85 | 3-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.