DPCstruct | MC0
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 12.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3ZAL7 | 4-118 | LIFLFVLTTTSFTTNLFKAQVNVNININSQPEWGPRGYNYVESYYLPEYDIYYNVPKRRYYYFSGNRWLYSTALPVRYRHINLYQTH… |
| A0A537IMV5 | 3-112 | KIFICFALCLLAAFFKPASAQFSTNENIKDQPKWGLAGQKYVEYYYLPDIDTYYYVPGKQFIYQSGGYWTFSSRLSKANRSYDLRGG… |
| A0A170YWQ7 | 2-107 | None |
| A0A3E2NVG7 | 1-133 | None |
| A0A2W4V3S2 | 3-113 | None |
| A0A4R2EMX1 | 49-158 | None |
| A0A4R2EPD2 | 219-328 | None |
| A0A533BJV2 | 138-258 | None |
| A0A4Q3BL62 | 5-101 | None |
| A0A161LV53 | 39-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.