DPCfam | MC99830
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 136 ± 23 aa |
| Residues in low-complexity regions (%) | 2.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.9 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF15978 |
| Sequences matching dominant architecture (%) | 95.06 |
| Average overlap percent | 54.09 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DDD2EC | 358-490 | 133 | SVRAAAKSAGVDTQTGLMWAMQAQLPVIHRPKVVNPCLRRLIEDDLRKGCSKQSIAAIHGVSCTTVTRILLSHPAVSEQRDACMA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P37247-F1 | 3-52 | 34.01 | 92.93 | View in AlphaFoldDB ↗ |