DPCfam | MC99783
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 491 |
|---|---|
| Mean domain length (aa) | 295 ± 56 aa |
| Residues in low-complexity regions (%) | 4.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.33 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08190- PF18201 |
| Sequences matching dominant architecture (%) | 56.03 |
| Average overlap percent | 94.59 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B9WN59 | 22-269 | 248 | PKPGFVIKTKILESKDVSRTLTKVFINVCHSPDVPKPDVDFDPQIVFPLIIDNEWEIPIILSKEKESKDKKGFPSLVYDCCINSK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3Q0KI17-F1 | 26-420 | 99.66 | 78.02 | View in AlphaFoldDB ↗ |