DPCfam | MC99559
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Residues in low-complexity regions (%) | 0.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17242 |
| Sequences matching dominant architecture (%) | 98.0 |
| Average overlap percent | 87.88 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G0WB52 | 109-169 | 61 | LEKSEGVWSDIDTLDDVKKMAQDYKGDGFPSNFESNLDQMRRSNAKLLTAMRDRNERLQKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5A6L7-F1 | 90-149 | 96.72 | 79.90 | View in AlphaFoldDB ↗ |