DPCfam | MC9944
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 135 ± 9 aa |
| Residues in low-complexity regions (%) | 3.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.8 |
| Average transmembrane regions | 1.93 |
| Dominant Pfam architecture(s) | PF04217 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 97.3 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G5QLY4 | 3-107 | 105 | DGKTAGMTRYAIRFMPPVAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQALA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9KT06-F1 | 10-144 | 98.54 | 89.31 | View in AlphaFoldDB ↗ |