DPCfam | MC99336
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Residues in low-complexity regions (%) | 1.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13337 |
| Sequences matching dominant architecture (%) | 98.63 |
| Average overlap percent | 35.59 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V6L5C7 | 28-153 | 126 | LDLKINRHFPGAVVRKDLVKAVKGNAIVPSYVLEYLLGQYAASDDEATIQAGIDTVRKILADHYVLRNQSELVKSTIRERGRHRV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZK16-F1 | 23-151 | 99.23 | 90.14 | View in AlphaFoldDB ↗ |