DPCfam | MC99278
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Residues in low-complexity regions (%) | 0.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 52.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00791 |
| Sequences matching dominant architecture (%) | 68.52 |
| Average overlap percent | 2.26 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6KGB1 | 664-752 | 89 | EDTLLSEQPYRYLTVDEMKSLGDDSLPIDVRQDERIDSNRECMTVPPTAVDDTISPQHLKEAYSQFTTPDNIDIAKHTMHVGFLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0KIE7-F1 | 856-938 | 96.70 | 30.68 | View in AlphaFoldDB ↗ |