DPCfam | MC98690
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 271 ± 43 aa |
| Residues in low-complexity regions (%) | 30.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 76.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00786- PF02205- PF02205 |
| Sequences matching dominant architecture (%) | 59.18 |
| Average overlap percent | 84.81 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008117EB3 | 170-421 | 252 | KENRKQGKKKVTKEDIGMPTNFQHIHHIGWNSQTNHFEANKEIFNDTNLLTFLQSAGVTQDQLQDKNTVKFIYDFLDQHGGRDKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O08816-F1 | 199-363 | 64.29 | 68.08 | View in AlphaFoldDB ↗ |