DPCfam | MC98113
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Residues in low-complexity regions (%) | 11.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16069 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 27.88 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R2DUQ5 | 132-253 | 122 | EQTSAKLITTTTKWQFSSDFYKTLFKVEDSDSELISEKNEITVPKSNWLVLSADQAKSLAEKQQAMTDEQKQAQQTQLKQEVAKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132ZA48-F1 | 118-229 | 97.39 | 94.53 | View in AlphaFoldDB ↗ |