DPCfam | MC98022
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 99 ± 18 aa |
| Residues in low-complexity regions (%) | 0.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.84 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF17787 |
| Sequences matching dominant architecture (%) | 95.31 |
| Average overlap percent | 71.15 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003EC6144 | 1-103 | 103 | MTKSYEFNWEKHLPEFMQEGASFDRFDEDPYIFEPNCHMEVDEYGFFITWKSEGKEGQVLECSLINSIRVGAVPKDPKILSSFEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P25455-F1 | 14-126 | 95.04 | 92.54 | View in AlphaFoldDB ↗ |