DPCfam | MC9801
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 296 ± 41 aa |
| Residues in low-complexity regions (%) | 10.33 |
| Residues in coiled-coil regions (%) | 38.05 |
| Predicted disordered residues (%) | 48.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12763 |
| Sequences matching dominant architecture (%) | 80.97 |
| Average overlap percent | 27.54 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0DN25 | 102-351 | 250 | QPPIYDIQSEQLQKYENYFLTIDQEGTQIIQGMQARALFSKSGLSLDQLKELWNLCDIGEKGHLNKGEFIVALHLVQLCSKFKYP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P42566-F1 | 218-502 | 98.33 | 88.07 | View in AlphaFoldDB ↗ |