DPCfam | MC97996
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 80 ± 12 aa |
| Residues in low-complexity regions (%) | 0.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14504 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 55.77 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R2HWK5 | 65-130 | 66 | IGISVDLFTQQFGEPVRKDETAYDFQWWIYNQKDKDYLQVGVKDGKIVTIFALGNNLDVAPFKIGM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34586-F1 | 59-133 | 91.46 | 95.01 | View in AlphaFoldDB ↗ |