DPCfam | MC97371
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 148 ± 15 aa |
| Residues in low-complexity regions (%) | 2.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.48 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166EI58 | 299-423 | 125 | LKGADRLVRVALNQLRLETNVQLLYRPEDAEDTFHPACGLSSKIIDMEYRDYDSGESDELVIIGNGTLSEESFGHESVLWVTPPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2FFV7-F1 | 364-543 | 97.37 | 84.90 | View in AlphaFoldDB ↗ |