DPCfam | MC9737
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 676 ± 67 aa |
| Residues in low-complexity regions (%) | 11.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 68.57 |
| Average transmembrane regions | 0.94 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7UBU0 | 62-721 | 660 | DDTSAACEKPVGPSAYTLPVILGIVIPVGGAIILFTILQRRYMKKAREEDLNDPTKNMDFGMGRISRTAGGESGISNFDDEKGGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PL16-F1 | 41-848 | 99.55 | 52.78 | View in AlphaFoldDB ↗ |