DPCfam | MC97284
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 186 ± 9 aa |
| Residues in low-complexity regions (%) | 1.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.36 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03787 |
| Sequences matching dominant architecture (%) | 95.24 |
| Average overlap percent | 22.48 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q9K628 | 195-370 | 176 | NAVNDELSGLRISDSKPLETDCLVLCQKIDRHIEGKDRNMPLLRECIKPGVEITFELTIDTSVCNYSEQDILNAISRVYERNSAF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P9WJF4-F1 | 195-371 | 98.91 | 91.33 | View in AlphaFoldDB ↗ |