DPCfam | MC97259
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 455 ± 55 aa |
| Residues in low-complexity regions (%) | 4.18 |
| Residues in coiled-coil regions (%) | 0.13 |
| Predicted disordered residues (%) | 6.77 |
| Average transmembrane regions | 0.74 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D3C467 | 979-1459 | 481 | VKMPPESTTLHGHILKYFVVFSNMEDQNSIIKIFHAANNCIQRCPSVIRALWAVPAILFSLKMEENLLAQERVCVFLSLLLQHFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1M723-F1 | 937-1425 | 99.80 | 77.16 | View in AlphaFoldDB ↗ |