DPCfam | MC96237
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Residues in low-complexity regions (%) | 8.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00243 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 29.36 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B9TW64 | 72-161 | 90 | SLDAELLRQQRRFSSPRVLLSENTPLEPPPLYLMEEPMVLNRTSRRKRYTEGKTHRGEYSVCDSESRWVTDKTSAVDIRGHQVTV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P25435-F1 | 101-191 | 94.74 | 74.98 | View in AlphaFoldDB ↗ |