DPCfam | MC96106
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 7761 |
|---|---|
| Mean domain length (aa) | 220 ± 28 aa |
| Residues in low-complexity regions (%) | 2.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00849 |
| Sequences matching dominant architecture (%) | 62.93 |
| Average overlap percent | 71.21 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A174UK80 | 52-283 | 232 | KSVLQVGDSLHIHIPEADNTENILPVRMDLSILYEDEDILVINKAADMPVHPSIGNYDNTLANGVAWYYKEKGQHFVYRCINRLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132Z073-F1 | 80-274 | 99.05 | 94.21 | View in AlphaFoldDB ↗ |