DPCfam | MC96072
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 78 ± 11 aa |
| Residues in low-complexity regions (%) | 10.43 |
| Residues in coiled-coil regions (%) | 39.84 |
| Predicted disordered residues (%) | 34.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3UFE9 | 21-92 | 72 | VIPPTNKKEYCQMSISELVSVLRIAFKIEDFDKIEEELVKREAQFRGEIERLQEKIELERLQAIEYEERLRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7MQL1-F1 | 16-87 | 94.74 | 90.64 | View in AlphaFoldDB ↗ |