DPCfam | MC96032
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Residues in low-complexity regions (%) | 7.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.56 |
| Average transmembrane regions | 0.52 |
| Dominant Pfam architecture(s) | PF12787 |
| Sequences matching dominant architecture (%) | 5.38 |
| Average overlap percent | 32.26 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Z8WU00 | 49-128 | 80 | KVSKTVGANIGKKVAMQALTKTTWYPLVKKVAAVIGVKITKKTVEKTIANAVPILGGLISGGLTYFTFQPMGGMLADTFV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8DQV0-F1 | 170-245 | 92.68 | 74.72 | View in AlphaFoldDB ↗ |