DPCfam | MC96017
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 131 ± 17 aa |
| Residues in low-complexity regions (%) | 1.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.87 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05426 |
| Sequences matching dominant architecture (%) | 99.49 |
| Average overlap percent | 39.81 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L0FYU3 | 417-546 | 130 | VAKLKECADYALTQGPWSVIRKTERPPSRDVHDYYTPKPYFWPNPNTRNGLPYIRLDGQRVPGTELYDKESDKFDRTRLAAMYGN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PJQ0-F1 | 39-177 | 98.56 | 96.33 | View in AlphaFoldDB ↗ |