DPCfam | MC95966
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 147 ± 17 aa |
| Residues in low-complexity regions (%) | 9.11 |
| Residues in coiled-coil regions (%) | 9.32 |
| Predicted disordered residues (%) | 36.23 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A093X7N5 | 121-252 | 132 | DSYDDLSISAGKAGDAQAEALAKIGLDTTDLASVSKADLEIIKGIHDVANDAEVGAFNPALDDATDKTEKTAIQNGKIKNKVLKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2E0A5-F1 | 26-165 | 95.24 | 97.14 | View in AlphaFoldDB ↗ |