DPCfam | MC95930
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 391 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Residues in low-complexity regions (%) | 2.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.24 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08698 |
| Sequences matching dominant architecture (%) | 98.27 |
| Average overlap percent | 83.62 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V9XZY8 | 154-267 | 114 | KRHRQAEREKNAGHNWFGMAKPELTTERKRDLEVLKMRKVLDTKTFYKKNDIQQLPKYFEIGTVMDNATDFYSDRIPKKQRKQTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5QJE6-F1 | 634-741 | 98.18 | 93.54 | View in AlphaFoldDB ↗ |