DPCfam | MC95849
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 1088 ± 157 aa |
| Residues in low-complexity regions (%) | 3.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.9 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF15780 |
| Sequences matching dominant architecture (%) | 7.69 |
| Average overlap percent | 7.15 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004C20E66 | 2539-3912 | 1374 | TRSPERDPSSTGTASAPEKPVRLSSCRWVVPAHGKVKLQVHFSSSELGQFDQTLHFEILGTNRLYQLHCRGICTYPSISQDPRVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4CP27-F1 | 309-1443 | 99.90 | 78.27 | View in AlphaFoldDB ↗ |