DPCfam | MC9567
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Residues in low-complexity regions (%) | 4.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.52 |
| Average transmembrane regions | 0.61 |
| Dominant Pfam architecture(s) | PF07353 |
| Sequences matching dominant architecture (%) | 6.98 |
| Average overlap percent | 57.13 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B0FP48 | 134-211 | 78 | HVLRVGNDTHCQPTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVPGPQSPGTVVIIAILSI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q864V4-F1 | 127-222 | 95.92 | 87.93 | View in AlphaFoldDB ↗ |