DPCfam | MC9535
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Residues in low-complexity regions (%) | 3.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.91 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF03063 |
| Sequences matching dominant architecture (%) | 98.81 |
| Average overlap percent | 26.92 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F9N4Y0 | 613-709 | 97 | IAAELGLNLPQMPFAMSSPEWSNEKGIDASLGFRLMGINSYHCVEPPTQGSDAVTKWLKEDTKDILGSVMYVNTDPAKVAEKILA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8Q0L5-F1 | 518-627 | 99.10 | 97.51 | View in AlphaFoldDB ↗ |