DPCfam | MC95320
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 411 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Residues in low-complexity regions (%) | 2.89 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 16.08 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF13634 |
| Sequences matching dominant architecture (%) | 0.32 |
| Average overlap percent | 1.12 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A077ZZ37 | 761-867 | 107 | RSITLDELIIDQSSSGYWRSIDLIQSFIKEDIKSDQVFIQEIMDAISDKSAFEQILLTLVALMILAKKFGKKKSEWQLIAQKARD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X1WE72-F1 | 32-116 | 95.56 | 90.00 | View in AlphaFoldDB ↗ |