DPCfam | MC94992
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1071 |
|---|---|
| Mean domain length (aa) | 348 ± 71 aa |
| Residues in low-complexity regions (%) | 1.94 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 15.21 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF00271- PF02889 |
| Sequences matching dominant architecture (%) | 59.11 |
| Average overlap percent | 69.15 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A6QZE8 | 1067-1373 | 307 | LLKRIDEQALAESISHGIGYYHEALSNSDKRIVTHLFKLGAIQVMLASRDVCWEINFNAHLVIVMNTQFFDGREHRYIDYPISEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VUV9-F1 | 811-1142 | 97.74 | 88.67 | View in AlphaFoldDB ↗ |