DPCfam | MC9458
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 791 |
|---|---|
| Mean domain length (aa) | 208 ± 18 aa |
| Residues in low-complexity regions (%) | 1.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.36 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF08889 |
| Sequences matching dominant architecture (%) | 90.64 |
| Average overlap percent | 92.36 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J4TUE1 | 2-219 | 218 | ISIHQSQFLPWLPYFYKILKSDIFIIMDDVQFQKNGVQNRNSIKTPIGEIYLTIPVSTKSNTLINEVEISNGNTLNKILKTIQMN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P9WLW4-F1 | 5-222 | 99.52 | 97.17 | View in AlphaFoldDB ↗ |