DPCfam | MC94328
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 83 ± 19 aa |
| Residues in low-complexity regions (%) | 4.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.57 |
| Average transmembrane regions | 0.12 |
| Dominant Pfam architecture(s) | PF02540 |
| Sequences matching dominant architecture (%) | 95.92 |
| Average overlap percent | 36.01 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R1EP25 | 346-450 | 105 | TRARAKDLAKHIGAYHTDLDIDSVATALKTLFTTVTGFVPQFRVHGGSNTENLALQNIQARIRMVIAYLFAQLLPVVRGRKVSGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZMA6-F1 | 434-529 | 100.00 | 96.38 | View in AlphaFoldDB ↗ |