DPCfam | MC94304
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 511 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Residues in low-complexity regions (%) | 3.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00990 |
| Sequences matching dominant architecture (%) | 96.0 |
| Average overlap percent | 14.04 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000416087F | 498-592 | 95 | VVILAGLDQEHIWADILDRFAQVAPIFYDPEDQAAGGIHTRDRRGQTQFFPVSSLSIGVVPCPVGRFTHPQEIAHAASMVKAQAK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HYY2-F1 | 497-593 | 94.90 | 90.65 | View in AlphaFoldDB ↗ |